PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G085500.1.p
Common NameGLYMA_11G085500, LOC100306328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 332aa    MW: 38388.8 Da    PI: 8.8604
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G085500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK841.4e-26204253352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++isl+dl kyF +pi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  Glyma.11G085500.1.p 204 AKISLSDLVKYFGMPIVEASRNLNVGLTVLKRKCREFGIPRWPHRKIKSL 253
                          589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.429188273IPR003035RWP-RK domain
PfamPF020421.1E-21206253IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MDSSHTNTTL LTNLLVFNNT LQPELMRSVH VYRRGGGEKR EVEREFVFSE SGSYVEMQAT  60
PIPGLVKSRV SEVCEGHRNG VWLCVFAFHA DHTPQFCRIP RLLLVTRNPK LKMIPNLLDD  120
LHMIYKLNRK EEDRDIAQDS TGEERQGHSN NFQPSRKVFP VLDQDLNFLP YEDYESESPD  180
NETDVESSPG FLVKKKRAPS DLVAKISLSD LVKYFGMPIV EASRNLNVGL TVLKRKCREF  240
GIPRWPHRKI KSLDSLIHDL QEEAKNQELE DREAAMAVAK RQRMLESEKE NIEKKPFMDI  300
KIETKRFRQD VFKRRHRARA VEKHNSTVSS T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.289270.0cotyledon| seed coat| somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0903770.0BT090377.1 Soybean clone JCVI-FLGm-4G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618960.10.0PREDICTED: uncharacterized protein LOC100306328 isoform X1
SwissprotO817914e-92RKD5_ARATH; Protein RKD5
TrEMBLA0A0B2SAS90.0A0A0B2SAS9_GLYSO; Protein RKD5
TrEMBLA0A0R0HMB10.0A0A0R0HMB1_SOYBN; Uncharacterized protein
STRINGGLYMA01G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-82RWP-RK domain-containing protein